Pfam domain
Pfam family: Ribosomal_S19e (PF01090.18)
Uniprot AC: G1TN62
RecName: Uncharacterized protein
Begin-End: 5-141
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHL
YLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDWGRKLT
PQGQRDLDRIAGQVAAA
Structures of the domain G1TN62 5-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 T 5-139 None
4kzx X-ray 7.81 T 5-139 None
4kzz X-ray 7.03 T 5-139 None
4kzy X-ray 7.01 T 5-139 None
5k0y X-ray 5.8 R 10-139 None
4d61 X-ray 9 T 5-139 None


© NPIDB team 2003 - 2019

text