Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: G1TN72
RecName: 40S ribosomal protein S3a
Begin-End: 19-221
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
KKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE
VAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLHLF
CVGFTKKCNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIE
KACQSIYPLHDVFVRKVKMLKKP
Structures of the domain G1TN72 19-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 B 19-221 None
4kzz X-ray 7.03 B 1-221 None
4kzy X-ray 7.01 B 1-221 None
5k0y X-ray 5.8 i 19-221 None


© NPIDB team 2003 - 2019

text