Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: G1TNM3
RecName: Uncharacterized protein
Begin-End: 58-134
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
ELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGF
PEGSVELYAEKVATRGL
Structures of the domain G1TNM3 58-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 D 20-93 None
4kzx X-ray 7.81 D 23-93 None
4kzz X-ray 7.03 D 23-93 None
4kzy X-ray 7.01 D 23-93 None
5k0y X-ray 5.8 g 20-93 None
4d61 X-ray 9 D 22-93 None


© NPIDB team 2003 - 2019

text