Pfam domain
Pfam family: Ribosomal_S17_N (PF16205.4)
Uniprot AC: G1TRM4
RecName: Uncharacterized protein
Begin-End: 5-73
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTG
NVSIRGRIL
Structures of the domain G1TRM4 5-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 L 5-73 None
4kzx X-ray 7.81 L 33-101 None
4kzz X-ray 7.03 L 5-73 None
4kzy X-ray 7.01 L 5-73 None
5k0y X-ray 5.8 G 5-73 None
4d61 X-ray 9 L 5-73 None


© NPIDB team 2003 - 2019

text