Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: G1TRM4
RecName: Uncharacterized protein
Begin-End: 75-144
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPL
SKTVRFNVLK
Structures of the domain G1TRM4 75-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 L 75-144 None
4kzx X-ray 7.81 L 103-144 None
4kzz X-ray 7.03 L 75-144 None
4kzy X-ray 7.01 L 75-144 None
5k0y X-ray 5.8 G 75-144 None
4d61 X-ray 9 L 75-144 None


© NPIDB team 2003 - 2019

text