Pfam domain
Pfam family: Ribosomal_S24e (PF01282.18)
Uniprot AC: G1TS40
RecName: 40S ribosomal protein S24
Begin-End: 24-102
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
VIDVLHPGKATVPKTEIQEKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAK
KNEPKHRLARHGLYEKKKT
Structures of the domain G1TS40 24-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 Y 24-101 None
4kzx X-ray 7.81 Y 24-101 None
4kzz X-ray 7.03 Y 24-101 None
4kzy X-ray 7.01 Y 24-101 None
5k0y X-ray 5.8 s 24-101 None
4d61 X-ray 9 Y 24-101 None


© NPIDB team 2003 - 2019

text