Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: G1TUT9
RecName: Uncharacterized protein
Begin-End: 82-146
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
LKDEVLKIMPVQKQTRAAQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLS
IVPVR
Structures of the domain G1TUT9 82-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 C 53-166 None
5k0y X-ray 5.8 c 87-151 None


© NPIDB team 2003 - 2019

text