Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: G1TWL4
RecName: 40S ribosomal protein SA
Begin-End: 111-184
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
QIQAAFREPRLLVVTDPQADHQPLMEASYVNLPTIALCNTDSPLHYVDIAILCNNKGAHS
VGLMWWMLAQEVLR
Structures of the domain G1TWL4 111-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 A 114-182 None
5k0y X-ray 5.8 f 114-182 None
4d61 X-ray 9 A 114-182 None


© NPIDB team 2003 - 2019

text