Pfam domain
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: G1TZ76
RecName: 40S ribosomal protein S27
Begin-End: 28-82
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
PNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRK
Structures of the domain G1TZ76 28-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 b 45-99 None
4kzx X-ray 7.81 b 46-100 None
4kzz X-ray 7.03 b 28-82 None
4kzy X-ray 7.01 b 28-82 None
5k0y X-ray 5.8 Y 28-82 None
4d61 X-ray 9 b 28-82 None


© NPIDB team 2003 - 2019

text