Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: G1U0Q2
RecName: Uncharacterized protein
Begin-End: 43-128
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
RRLSRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTF
NQVEIKPEMIGHYLGEFSITYKPVKH
Structures of the domain G1U0Q2 43-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 P 43-128 None
4kzx X-ray 7.81 P 43-128 None
4kzz X-ray 7.03 P 43-128 None
4kzy X-ray 7.01 P 43-128 None
5k0y X-ray 5.8 n 40-128 None
4d61 X-ray 9 P 43-128 None


© NPIDB team 2003 - 2019

text