Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.14)
Uniprot AC: G1U2Z9
RecName: Uncharacterized protein
Begin-End: 119-190
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TGRCGSVLVRLIPAPRGTGIISAPVPKKLLLMAGIDDCYTSAGGCTATLGNFAKATFDAI
SKTYSYLTPDLW
Structures of the domain G1U2Z9 119-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 C 170-241 None
4kzz X-ray 7.03 C 170-241 None
4kzy X-ray 7.01 C 170-241 None


© NPIDB team 2003 - 2019

text