Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: G1U2Z9
RecName: Uncharacterized protein
Begin-End: 38-100
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
VKDMKIMPVQKQTQAGQRTRFKAFVAIGDYNGHVGLGMKCSKEVATAIRGAIILAKLSIV
PVR
Structures of the domain G1U2Z9 38-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 C 54-151 None
4kzz X-ray 7.03 C 87-151 None
4kzy X-ray 7.01 C 87-151 None


© NPIDB team 2003 - 2019

text