Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: G1U472
RecName: Uncharacterized protein
Begin-End: 29-147
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKEL
GITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRR
Structures of the domain G1U472 29-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 O 29-147 None
4kzx X-ray 7.81 O 29-147 None
4kzz X-ray 7.03 O 29-147 None
4kzy X-ray 7.01 O 29-147 None


© NPIDB team 2003 - 2019

text