Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: G3MZY8
RecName: DNA-directed RNA polymerase subunit
Begin-End: 15-354
Organism: Bos taurus
Interaction Mode:   

Sequence:
LRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTC
AGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSK
GQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRS
GLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLP
VPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHV
ATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNL
Structures of the domain G3MZY8 15-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 A 16-354 None
5flm X-ray 3.4 A 16-354 None


© NPIDB team 2003 - 2019

text