Pfam domain
Pfam family: RNA_pol_Rpb1_6 (PF04992.13)
Uniprot AC: G3MZY8
RecName: DNA-directed RNA polymerase subunit
Begin-End: 896-1079
Organism: Bos taurus
Interaction Mode:   

Sequence:
LAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELERE
FERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKE
LSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESK
FNQA
Structures of the domain G3MZY8 896-1079
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 A 896-1079 None
5flm X-ray 3.4 A 896-1079 None


© NPIDB team 2003 - 2019

text