Pfam domain
Pfam family: Arc (PF03869.13)
Uniprot AC: G3XCY4
RecName: Alginate and motility regulator Z
Begin-End: 16-62
Organism: Pseudomonas aeruginosa
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
ADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQD
Structures of the domain G3XCY4 16-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qoq X-ray 3.1 D 16-62  S-Bb S-Mj 
3qoq X-ray 3.1 C 13-58  H-Bb S-Mj L-Bb L-Mj 
3qoq X-ray 3.1 B 16-59  H-Bb S-Bb S-Mj 
3qoq X-ray 3.1 A 13-59  H-Bb S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2020

text