Pfam domain
Pfam family: Flu_PB2 (PF00604.16)
Uniprot AC: H6QM90
RecName: Polymerase basic protein 2
Begin-End: 1-741
Organism: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10))
Interaction Mode:   

Sequence:
MERIKELMEMVKNSRMREILTTTSVDHMAVIKKYTSGRQEKNPALRMKWMMAMKYPISAS
SRIREMIPEKDEDGNTLWTNTKDAGSNRVLVSPNAVTWWNRAGPVSDVVHYPRVYKMYFD
RLERLTHGTFGPVKFYNQVKVRKRVDINPGHKDLTSREAQEVIMEVVFPNEVGARTLSSD
AQLTITKEKKEELKNCKISPIMVAYMLERELVRRTRFLPIAGATSSTYVEVLHLTQGTCW
EQQYTPGGEAENDDLDQTLIIASRNIVRRSIVAIDPLASLLSMCHTTSISSEPLVEILRS
NPTDEQAVNICKAALGIRINNSFSFGGYNFKRVKGSSQRTEKAVLTGNLQTLTMTIFEGY
EEFNVSGKRASAVLKKGAQRLIQAIIGGRTLEDILNLMITLMVFSQEEKMLKAVRGDLNF
VNRANQRLNPMYQLLRHFQKDSSTLLKNWGTEEIDPIMGIAGIMPDGTINKTQTLMGVRL
SQGGVDEYSFNERIRVNIDKYLRVRNEKGELLISPEEVSEAQGQEKLPINYNSSLMWEVN
GPESILTNTYHWIIKNWELLKTQWMTDPTVLYNRIEFEPFQTLIPKGNRAIYSGFTRTLF
QQMRDVEGTFDSIQIIKLLPFSAHPPSLGRTQFSSFTLNIRGAPLRLLIRGNSQVFNYNQ
MENVIIVLGKSVGSPERSILTESSSIESAVLRGFLILGKANSKYGPVLTIGELDKLGRGE
KANVLIGQGDTVLVMKRKRDS
Structures of the domain H6QM90 1-741
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6evk X-ray 2.9 C 1-741 None
5m3h X-ray 2.5 C 1-742 None


© NPIDB team 2003 - 2019

text