Pfam domain
Pfam family: Flu_PA (PF00603.16)
Uniprot AC: H6QM92
RecName: Polymerase acidic protein
Begin-End: 21-710
Organism: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10))
Interaction Mode:   

Sequence:
MKEYGENPQNEGNKFAAISTHMEVCFMYSDFHFIDLEGNTIVKENDDDNAMLKHRFEIIE
GQERNIAWTIVNSICNMTENSKPRFLPDLYDYKTNKFIEIGVTRRKVEDYYYEKASKLKG
ENVYIHIFSFDGEEMATDDEYILDEESRARIKTRLFVLRQELATAGLWDSFRQSEKGEET
LEEEFSYPPTFQRLANQSLPPSFKDYHQFKAYVSSFKANGNIEAKLGAMSEKVNAQIESF
DPRTIRELELPEGKFCTQRSKFLLMDAMKLSVLNPAHEGEGIPMKDAKACLDTFWGWKKA
TIIKKHEKGVNTNYLMIWEQLLESIKEMEGKFLNLKKTNHLKWGLGEGQAPEKMDFEDCK
EVPDLFQYKSEPPEKRKLASWIQSEFNKASELTNSNWIEFDELGNDVAPIEHIASRRRNF
FTAEVSQCRASEYIMKAVYINTALLNSSCTAMEEYQVIPIITKCRDTSGQRRTNLYGFII
KGRSHLRNDTDVVNFISLEFSLTDPRNEIHKWEKYCVLEIGDMEIRTSISTIMKPVYLYV
RTNGTSKIKMKWGMEMRRCLLQSLQQVESMIEAESAVKEKDMTEPFFRNRENDWPIGESP
QGIEKGTIGKVCRVLLAKSVFNSIYASAQLEGFSAESRKLLLLIQAFRDNLDPGTFDLKG
LYEAIEECIINDPWVLLNASWFNSFLKAVQ
Structures of the domain H6QM92 21-710
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6evk X-ray 2.9 A 21-708 None
5m3h X-ray 2.5 A 21-708 None


© NPIDB team 2003 - 2019

text