Pfam domain
Pfam family: CarD_CdnL_TRCF (PF02559.15)
Uniprot AC: H9ZP94
RecName: CarD-like transcriptional regulator
Begin-End: 4-112
Organism: Thermus thermophilus JL-18
Interaction Mode:  H-Mn 

Sequence:
FRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKAL
APEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQL
Structures of the domain H9ZP94 4-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 N 4-108 None
4xls X-ray 4.01 M 4-108 None
4xlr X-ray 4.3 M 4-108  H-Mn 
4xlr X-ray 4.3 N 4-108  H-Mn 


© NPIDB team 2003 - 2019

text