Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: I3LEJ9
RecName: Mitoribosomal protein bs6m, mrps6
Begin-End: 3-95
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGG
YFLVDFYAPATTVESMMEHLSRDIDVIRPNIVK
Structures of the domain I3LEJ9 3-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aj3 X-ray 3.6 F 3-95 None


© NPIDB team 2003 - 2019

text