Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: I3LNJ0
RecName: Mitochondrial ribosomal protein L19
Begin-End: 104-209
Organism: Sus scrofa
Interaction Mode:   

Sequence:
QIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILR
NTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYS
Structures of the domain I3LNJ0 104-209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 T 107-193 None


© NPIDB team 2003 - 2019

text