Pfam domain
Pfam family: Ribosomal_L9_N (PF01281.18)
Uniprot AC: I3LR45
RecName: Uncharacterized protein
Begin-End: 94-140
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLF
Structures of the domain I3LR45 94-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 I 95-139 None


© NPIDB team 2003 - 2020

text