Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: I3LTC4
RecName: Uncharacterized protein
Begin-End: 98-155
Organism: Sus scrofa
Interaction Mode:   

Sequence:
AAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYEKVRKETAE
Structures of the domain I3LTC4 98-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 5 81-134 None


© NPIDB team 2003 - 2019

text