Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: I6YEU6
RecName: 50S ribosomal protein L28
Begin-End: 3-62
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
AVCDICGKGPGFGKSVSHSHRRTSRRWDPNIQTVHAVTRPGGNKKRLNVCTSCIKAGKIT
Structures of the domain I6YEU6 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 X 4-60 None


© NPIDB team 2003 - 2019

text