Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: I7F541
RecName: Type-4 uracil-DNA glycosylase
Begin-End: 44-208
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
FGAGGRSARIMMIGEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFK
FTRAAGGKRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQH
RGEVLHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLR
Structures of the domain I7F541 44-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6iod X-ray 1.66 A 38-202 None
6iod X-ray 1.66 B 38-202 None
6l6s X-ray 2.06 A 38-202 None
6l6s X-ray 2.06 B 38-202 None


© NPIDB team 2003 - 2021

text