Pfam domain
Pfam family: UvrD-helicase (PF00580.23)
Uniprot AC: I7FZ56
RecName: DNA helicase
Begin-End: 27-341
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
PTDEQAAVIAAPPGPLVVIAGAGAGKTETMAARVVWLVANGFATPSQVLGLTFTRKAAGQ
LLRRVRTRLARLAGAGLAPGSGASDESATVSTYHAFAGTLLREHGLLLPVEPDTRLLSET
ELWQLAYDVVCAHPGHLDTEKTPAAVTAMVLRLSGALAEHLVDTDQLRDTHVELERLVHT
LPAGPYQRDRGPSQWLLRMLATQTERTELVPLIDALHQRMRAEKVMDFGMQMAAAARLAA
RFPQVGEQLRQRFRVVLLDEYQDTGHAQRIALSSLFGGGADDGLALTAVGDPIQSIYGWR
GASATNLPRFTTDFP
Structures of the domain I7FZ56 27-341
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ppu X-ray 3.5 B 27-339 None
6ppr X-ray 3.5 B 27-341  L-Bb 


© NPIDB team 2003 - 2021

text