Pfam domain
Pfam family: UvrD_C (PF13361.8)
Uniprot AC: I7FZ56
RecName: DNA helicase
Begin-End: 351-522
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
LELRTSWRNPPSTLHVANAVSEEARRRSVAVRALRPRPDAEPGTIRCALLNNVAAERDWV
ADHLARAYHGAIGRGEAAPTAAVLVRRNADAAPMAEALTARGVPVEVVGVAGLLAVPEVA
DLVAMLRLIADPTAGSAVMRILTGPRWRFGARDIAALWRRAVELDDRPKGEL
Structures of the domain I7FZ56 351-522
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ppu X-ray 3.5 B 351-538 None


© NPIDB team 2003 - 2021

text