Pfam domain
Pfam family: UvrD_C (PF13361.8)
Uniprot AC: I7FZ56
RecName: DNA helicase
Begin-End: 567-771
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
ELTMLRAHLGHPLPELVAEVRRVLGLDAEARAARPVAAGWAGTENLDRFSDLVSDFAGHA
GASVSALLAYLDAAVEVENGLAPAELTVSHDRVQILTVHAAKGLEWQVVAVPHLSARVFP
STTQARTWLTDASDLPPLLRGDRATESEIGVPVLDTSDIYDRKILSDKISDHKKSLDQRR
VDEERRLLYVAITRAEDTLLLSGHH
Structures of the domain I7FZ56 567-771
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ppu X-ray 3.5 B 594-771  L-Bb 
6ppr X-ray 3.5 B 579-771  L-Bb 


© NPIDB team 2003 - 2021

text