Pfam domain
Pfam family: Cas9_PI (PF16595.7)
Uniprot AC: J7M7J1
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 1102-1358
Organism: Streptococcus pyogenes M1 476
Interaction Mode:   

Sequence:
TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVK
ELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQ
KGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVI
LADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKE
VLDATLIHQSITGLYET
Structures of the domain J7M7J1 1102-1358
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mcc X-ray 3.9 A 1102-1358 None
6mcb X-ray 3.4 A 1102-1358 None


© NPIDB team 2003 - 2021

text