Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: J7RUA5
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 636-784
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
SVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERN
KGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFI
TPHQIKHIKDFKDYKYSHRVDKKPNRELI
Structures of the domain J7RUA5 636-784
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5czz X-ray 2.6 A 636-696 None
5axw X-ray 2.7 A 636-696 None


© NPIDB team 2003 - 2021

text