Pfam domain
Pfam family: Spt5-NGN (PF03439.12)
Uniprot AC: O00267
RecName: Transcription elongation factor SPT5
Begin-End: 178-264
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQ
AIEGVGNLRLGYWNQQMVPIKEMTDVL
Structures of the domain O00267 178-264
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 Z 178-264 None


© NPIDB team 2003 - 2019

text