Pfam domain
Pfam family: RPOL_N (PF14700.8)
Uniprot AC: O00411
RecName: DNA-directed RNA polymerase, mitochondrial
Begin-End: 410-704
Organism: Homo sapiens
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb L-Mj 

Sequence:
SRVCVVSVEKPTLPSKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYP
FLCLLDEREVVRMLLQVLQALPAQGESFTTLARELSARTFSRHVVQRQRVSGQVQALQNH
YRKYLCLLASDAEVPEPCLPRQYWEELGAPEALREQPWPLPVQMELGKLLAEMLVQATQM
PCSLDKPHRSSRLVPVLYHVYSFRNVQQIGILKPHPAYVQLLEKAAEPTLTFEAVDVPML
CPPLPWTSPHSGAFLLSPTKLMRTVEGATQHQELLETCPPTALHGALDALTQLGN
Structures of the domain O00411 410-704
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ola X-ray 3.9 F 410-704  L-Mj 
5ola X-ray 3.9 E 410-704  L-Bb L-Mj 
6erp X-ray 4.5 B 410-704  S-Bb L-Mj L-Mn 
6erp X-ray 4.5 A 410-704  L-Mj L-Mn 
4boc X-ray 2.65 A 410-704  S-Bb S-Mj S-Mn L-Bb L-Mj 
6erq X-ray 4.5 B 410-704  L-Mj L-Mn 
6erq X-ray 4.5 A 410-704  L-Mj L-Mn 


© NPIDB team 2003 - 2021

text