Pfam domain
Pfam family: RNA_pol (PF00940.18)
Uniprot AC: O00411
RecName: DNA-directed RNA polymerase, mitochondrial
Begin-End: 831-1230
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
RPLGPHGLDWLKIHLVNLTGLKKREPLRKRLAFAEEVMDDILDSADQPLTGRKWWMGAEE
PWQTLACCMEVANAVRASDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSD
VPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLEGFITRKVVKQTVMTVVYGVTRYGGRLQI
EKRLRELSDFPQEFVWEASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEW
VTPLGVPVIQPYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLDSS
HMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKR
FCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS
Structures of the domain O00411 831-1230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6erp X-ray 4.5 A 831-1230  S-Bb L-Bb L-Mj 
6erp X-ray 4.5 B 831-1230  S-Bb L-Bb L-Mj 
4boc X-ray 2.65 A 831-1230  H-Bb H-Mj H-Mn L-Bb 
5ola X-ray 3.9 E 831-1230 None
5ola X-ray 3.9 F 831-1230 None
6erq X-ray 4.5 A 831-1230  S-Bb S-Mj L-Bb L-Mj 
6erq X-ray 4.5 B 831-1230  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text