Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: O00482
RecName: Nuclear receptor subfamily 5 group A member 2
Begin-End: 84-153
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRF
QKCLSVGMKL
Structures of the domain O00482 84-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2a66 X-ray 2.2 A 85-152  H-Bb H-Mj S-Bb L-Bb 
5l0m X-ray 2.2 A 85-152  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text