Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: O01378
RecName: BmVLG protein
Begin-End: 417-526
Organism: Bombyx mori
Interaction Mode:   

Sequence:
EKRNSLKQLIEENDGKRILVFVETKRNADFIAAMLSEQQLLTSSIHGDRMQREREEALQN
FKSGKHCILVATAVAARGLDIKNVDIVVNYDLPKSIDEYVHRIGRTGRVG
Structures of the domain O01378 417-526
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d26 X-ray 2.1 A 418-526 None
4d25 X-ray 1.9 A 418-526 None


© NPIDB team 2003 - 2019

text