Pfam domain
Pfam family: PTS-HPr (PF00381.18)
Uniprot AC: O06976
RecName: HPr-like protein Crh
Begin-End: 2-83
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
VQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEV
TLIAQGEDEQEALEKLAAYVQE
Structures of the domain O06976 2-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zvv X-ray 2.98 W 3-82 None
1zvv X-ray 2.98 P 3-82 None
1zvv X-ray 2.98 J 3-82 None


© NPIDB team 2003 - 2020

text