Pfam domain
Pfam family: RAG1 (PF12940.6)
Uniprot AC: O13033
RecName: V(D)J recombination-activating protein 1
Begin-End: 408-1029
Organism: Danio rerio
Interaction Mode:  L-Mj 

Sequence:
GGRPRQHLLSLTRRAQKHRLRDLKNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQA
DELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRNAEK
ELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALK
DLEEDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIM
SISIRLEGEDDGITIFQEQKPNSELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMES
RLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLCDSTRAEASQNMVLHS
ITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFY
KIFQDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEA
VCELVPSEERREALLKLMDLYLQMKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFK
YRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRRFRKMNARQSKTFELE
DILKHHWLYTSKYLQKFMEAHK
Structures of the domain O13033 408-1029
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jbw X-ray 4.63 C 408-1029  L-Mj 
3jbw X-ray 4.63 A 408-1029 None


© NPIDB team 2003 - 2020

text