Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: O13033
RecName: V(D)J recombination-activating protein 1
Begin-End: 480-1029
Organism: Danio rerio
Interaction Mode:   

Sequence:
GLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRNAEKELLPGFHQFEWQ
PALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEEDIMEGLRE
RALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDG
ITIFQEQKPNSELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRS
FRFFFRGTGYDEKMVREMEGLEASGSTYICTLCDSTRAEASQNMVLHSITRSHDENLERY
EIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQDEIGEVYQ
KPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERRE
ALLKLMDLYLQMKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLH
KTLAHVPEIVERDGSIGAWASEGNESGNKLFRRFRKMNARQSKTFELEDILKHHWLYTSK
YLQKFMEAHK
Structures of the domain O13033 480-1029
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dbu X-ray 3.9 C 479-1028  H-Bb H-Mj L-Bb L-Mn 
6dbu X-ray 3.9 A 479-1028  H-Bb H-Mj L-Bb L-Mn 
6dbj X-ray 2.99 A 479-1030  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6dbj X-ray 2.99 C 479-1030  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
3jbx X-ray 3.4 A 480-1029  H-Bb H-Mj H-Mn L-Mj 
3jbx X-ray 3.4 C 480-1029  H-Bb H-Mj H-Mn L-Mj 
6dbr X-ray 4 C 480-1029  H-Bb H-Mj L-Bb L-Mj L-Mn 
6dbr X-ray 4 A 479-1028  H-Bb H-Mj L-Bb L-Mn 
3jby X-ray 3.7 A 480-1029  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
3jby X-ray 3.7 C 480-1029  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6dbo X-ray 4.45 A 480-1029  H-Bb H-Mj L-Bb L-Mj L-Mn 
6dbo X-ray 4.45 C 480-1029  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text