Pfam domain
Pfam family: RAG1 (PF12940.6)
Uniprot AC: O13033
RecName: V(D)J recombination-activating protein 1
Begin-End: 480-1029
Organism: Danio rerio
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
GLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRNAEKELLPGFHQFEWQ
PALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEEDIMEGLRE
RALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDG
ITIFQEQKPNSELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRS
FRFFFRGTGYDEKMVREMEGLEASGSTYICTLCDSTRAEASQNMVLHSITRSHDENLERY
EIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQDEIGEVYQ
KPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERRE
ALLKLMDLYLQMKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLH
KTLAHVPEIVERDGSIGAWASEGNESGNKLFRRFRKMNARQSKTFELEDILKHHWLYTSK
YLQKFMEAHK
Structures of the domain O13033 480-1029
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jby X-ray 3.7 C 480-1029  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
3jby X-ray 3.7 A 480-1029  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
3jbx X-ray 3.4 C 480-1029  H-Bb H-Mj H-Mn L-Mj 
3jbx X-ray 3.4 A 480-1029  H-Bb H-Mj H-Mn L-Mj 


© NPIDB team 2003 - 2020

text