Pfam domain
Pfam family: RAG2 (PF03089.16)
Uniprot AC: O13034
RecName: V(D)J recombination-activating protein 2
Begin-End: 51-351
Organism: Danio rerio
Interaction Mode:   

Sequence:
KKGELKLRAISFSNNSSYLPPLRCPAIAHFEAQDGKPECYLIHGGRTPNNELSSSLYMLS
VDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFGGRSYMPPTERTTQ
NWNSVGDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRP
SRLIRLHVELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYV
GLDDVGVHMESREPPQWTSEISHSRTWFGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSF
Q
Structures of the domain O13034 51-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dbu X-ray 3.9 D 51-351 None
6dbu X-ray 3.9 B 51-351 None
6dbx X-ray 4.2 D 51-351 None
6dbx X-ray 4.2 B 51-351 None
6dbj X-ray 2.99 D 51-351 None
6dbj X-ray 2.99 B 51-351 None
3jbw X-ray 4.63 B 51-351 None
3jbw X-ray 4.63 D 51-351 None
3jbx X-ray 3.4 D 51-351 None
3jbx X-ray 3.4 B 51-351 None
6dbq X-ray 4.22 B 51-351 None
6dbq X-ray 4.22 D 51-351 None
6dbi X-ray 3.36 B 51-351  S-Bb 
6dbi X-ray 3.36 D 51-351  S-Bb L-Mn 
6dbr X-ray 4 D 51-351  S-Bb L-Bb 
6dbr X-ray 4 B 51-351 None
3jby X-ray 3.7 D 51-351  S-Bb L-Bb 
3jby X-ray 3.7 B 51-351  S-Bb L-Bb 
6dbl X-ray 5 B 51-351 None
6dbl X-ray 5 D 51-351 None
6dbt X-ray 4.3 D 51-351 None
6dbt X-ray 4.3 B 51-351 None
6dbo X-ray 4.45 D 51-351  S-Bb L-Bb 
6dbo X-ray 4.45 B 51-351  L-Bb 
6dbw X-ray 4.7 D 51-351 None
6dbw X-ray 4.7 B 51-351  L-Bb 
6dbv X-ray 4.29 D 51-351 None
6dbv X-ray 4.29 B 51-351 None


© NPIDB team 2003 - 2021

text