Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: O13516
RecName: 40S ribosomal protein S9-A
Begin-End: 107-153
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSE
Structures of the domain O13516 107-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 J 107-150 None
5ll6 X-ray 3.9 W 107-150 None
6rbe X-ray 3.8 J 107-150 None
6rbd X-ray 3.47 J 107-150 None
5tzs X-ray 5.1 9 107-150 None
5jpq X-ray 7.3 u 107-150 None
6eml X-ray 3.6 W 107-150 None


© NPIDB team 2003 - 2020

text