Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: O14036
RecName: Small nuclear ribonucleoprotein Sm D2
Begin-End: 33-111
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
LQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTEKKRTASGKKGKAINK
DRFISKMFLRGDGVVLVVR
Structures of the domain O14036 33-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 l 61-124 None
3jb9 X-ray 3.6 G 33-103 None


© NPIDB team 2003 - 2019

text