Pfam domain
Pfam family: U6-snRNA_bdg (PF10596.8)
Uniprot AC: O14187
RecName: Pre-mRNA-splicing factor spp42
Begin-End: 1466-1624
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
FKQYQLLKNNPFWWTSQRHDGKLWQLNNYRVDVIQALGGVEGILEHTMFKATGFPSWEGL
FWEKASGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIM
MHGKIPTLKISLIQIFRSHLWQKIHESVVWDLCQVLDQE
Structures of the domain O14187 1466-1624
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 A 1466-1624 None


© NPIDB team 2003 - 2019

text