Pfam domain
Pfam family: PRP8_domainIV (PF12134.7)
Uniprot AC: O14187
RecName: Pre-mRNA-splicing factor spp42
Begin-End: 1784-2013
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
EQYLSSSNYAELFSNQIQLFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFL
KVIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPRQIIVTRKGMLDPLEVHLLDF
PNITIKGSELQLPFQAIIKLDKINDLILRATEPQMVLFNLYDDWLQSVSSYTAFSRLILI
LRALNVNTEKTKLILRPDKSIITKENHVWPNLDDQQWLDVEPKLRDLILA
Structures of the domain O14187 1784-2013
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 A 1784-2013 None


© NPIDB team 2003 - 2019

text