Pfam domain
Pfam family: Ribosomal_L36e (PF01158.17)
Uniprot AC: O14455
RecName: 60S ribosomal protein L36-B
Begin-End: 27-99
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAK
VEEMNNIIAASRR
Structures of the domain O14455 27-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 i 28-99 None
6em3 X-ray 3.2 i 28-99 None
6em5 X-ray 4.3 i 29-99 None


© NPIDB team 2003 - 2019

text