Pfam domain
Pfam family: HIN (PF02760.14)
Uniprot AC: O14862
RecName: Interferon-inducible protein AIM2
Begin-End: 150-317
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj 

Sequence:
QKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIII
ARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFV
VQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTL
Structures of the domain O14862 150-317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3rn2 X-ray 2.55 B 150-317  S-Bb L-Bb 
3rn2 X-ray 2.55 A 150-317  H-Bb S-Bb L-Bb 
3rn5 X-ray 2.5 B 150-317  S-Bb L-Bb 
3rn5 X-ray 2.5 A 150-317  H-Bb S-Bb L-Bb 
3rn5 X-ray 2.5 D 150-317  S-Bb L-Bb 
3rn5 X-ray 2.5 C 150-317  S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text