Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: O15119
RecName: T-box transcription factor TBX3
Begin-End: 105-305
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYK
FHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFP
SDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAY
QNDKITQLKIDNNPFAKGFRD
Structures of the domain O15119 105-305
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1h6f X-ray 1.7 B 105-285  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
1h6f X-ray 1.7 A 105-285  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text