Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: O15178
RecName: T-box transcription factor T
Begin-End: 44-219
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
VGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWK
YVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSL
HKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLD
Structures of the domain O15178 44-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f58 X-ray 2.25 A 44-219  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
6f58 X-ray 2.25 B 44-219  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
6f59 X-ray 2.15 B 44-219  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
6f59 X-ray 2.15 A 44-219  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text