Pfam domain
Pfam family: Btz (PF09405.9)
Uniprot AC: O15234
RecName: Protein CASC3
Begin-End: 168-248
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDE
QAPKSRQELIALYGYDIRSAH
Structures of the domain O15234 168-248
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2j0q X-ray 3.2 I 196-247 None
2j0q X-ray 3.2 T 197-247 None


© NPIDB team 2003 - 2019

text