Pfam domain
Pfam family: Btz (PF09405.9)
Uniprot AC: O15234
RecName: Protein CASC3
Begin-End: 169-230
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQ
AP
Structures of the domain O15234 169-230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2j0s X-ray 2.21 T 171-215 None


© NPIDB team 2003 - 2019

text