Pfam domain
Pfam family: Btz (PF09405.9)
Uniprot AC: O15234
RecName: Protein CASC3
Begin-End: 176-246
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQE
LIALYGYDIRS
Structures of the domain O15234 176-246
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hyi X-ray 2.3 J 195-246 None


© NPIDB team 2003 - 2019

text